PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10037668
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family GRF
Protein Properties Length: 237aa    MW: 26323.2 Da    PI: 8.9857
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10037668genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.31.5e-2465108144
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                  d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk  +
  Lus10037668  65 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKATV 108
                  79**************************************9765 PP

2QLQ62.79.6e-221650135
          QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35
                 s+FTa+Q+q+L++Q+l+yKy+++++P+Pp+Ll ++
  Lus10037668 16 SPFTATQWQELENQALIYKYMVSGLPIPPQLLSPL 50
                 89******************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.2E-111652IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.6241752IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.6E-161750IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.66865109IPR014977WRC domain
PfamPF088792.2E-2066106IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MMSTRTTNSN SSSCSSPFTA TQWQELENQA LIYKYMVSGL PIPPQLLSPL TWGSCFQVGF  60
SKKTDPEPGR CRRTDGKKWR CSKEAYPDSK YCERHMHRGK NRSRKATVDV SSSSSYAQNV  120
LSNVNAVGGI NQYGQSALFM DSAANSVSSP CQVHLPDYNR YVHGVKVEDN MQHQLSSSSS  180
SSKGYYCSPQ SDLQSFPYPS MRPISYSHET QKPLHQFFGG TTDHSWLDLA SSSRPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF92282022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-42growth-regulating factor 5